PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20836_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 240aa    MW: 27176.6 Da    PI: 8.8918
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20836_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.8e-1970122456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++t eq + Le +F +++++  +++ +LA++lgL  rqV vWFqNrRa++k
  Neem_20836_f_1  70 KRKLTVEQAQLLEMHFGNEHKLESDRKDKLASELGLHPRQVAVWFQNRRARDK 122
                     5689***********************************************99 PP

2HD-ZIP_I/II113.71.2e-3669160293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     kkr+l+ eq++lLE++F +e+kLe++rK +la+eLgl+prqvavWFqnrRAR ktk++E+ y++Lk+a+++++ e+ rLe++v++L+e+l++
  Neem_20836_f_1  69 KKRKLTVEQAQLLEMHFGNEHKLESDRKDKLASELGLHPRQVAVWFQNRRARDKTKKIEESYASLKTAHENVVVEKGRLESQVAKLKEKLSD 160
                     9***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003895.8E-1867128IPR001356Homeobox domain
SuperFamilySSF466894.28E-1669131IPR009057Homeodomain-like
CDDcd000861.74E-1469125No hitNo description
PROSITE profilePS5007115.66169124IPR001356Homeobox domain
PfamPF000466.8E-1670122IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1871131IPR009057Homeodomain-like
PRINTSPR000311.3E-595104IPR000047Helix-turn-helix motif
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5104120IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MIITNSMNHQ AEADNKNMVL LSQYYSPSFF TATAGMVPQQ GEASDTKPKR RQRKKNGGDH  60
NASCLTGLKK RKLTVEQAQL LEMHFGNEHK LESDRKDKLA SELGLHPRQV AVWFQNRRAR  120
DKTKKIEESY ASLKTAHENV VVEKGRLESQ VAKLKEKLSD AEKEIQRLTQ LYDAVSVNST  180
LNPTVAMEME TVNSPFASVD SSFANSNSTF TGYVGYEELH YLAEQNFITA VEWMLSNTQR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15271RKKNGGDHNASCLTGLKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425728.11e-95hypothetical protein CICLE_v10026414mg
RefseqXP_006466750.11e-95PREDICTED: homeobox-leucine zipper protein ATHB-40
TrEMBLA0A067GVJ66e-96A0A067GVJ6_CITSI; Uncharacterized protein
STRINGPOPTR_0005s12760.19e-57(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22082677
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-55homeobox protein 40